Interested to Buy Any Domain ? << Click Here >> for more details...
Answer Posted / jyotirindra majumdar
FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.
An example sequence in FASTA format is:
>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK
| Is This Answer Correct ? | 0 Yes | 0 No |
Post New Answer View All Answers
How to run DOCK 6 using cygwin?
How do you find the most recent human sequence data in the data bases inorder to determine physical maps?
what is the image of point (3,8) in the line x + 3y = 7 ?
What are the main differences between parsimony,distance and likelihood-based algorithms?
Suppose you used the NCBI Blast server to look for a match to a fruit-fly gene. Suppose further that the best alignment contained this section of an alignment: Hit from database: XXXXXXXXXXXXXXNFSTSQ User sequence: SLEAEAAPASISPSNFSSSQ What do the Xs signify?
How to find coexpressed genes on NCBI GEO?
what is a qi number?
How to Insert Genomic DNA into yeast ?
Have the proteins of a family generally acquired distinctive properties within each of these three kingdoms for ancient families that arose before bacteria, archaea and eukaryotes diverged?
what is an active ? (UML)
Does multidrug resistance (mdr) arise by activation of stable genes encoding drug efflux pumps or by mutations of genes encoding other types of transporters in bacterial pathogens?
How to caculate coordinates of each atoms on 3 D HP model?
What is a DNA array?
An electron is injected into a region of uniform magnetic flux density with the components of velocity parallel to and normal to the flux. What is the path of the electron?
Suppose the Blast search returned 100 hits. Of these, 17 were false positives and we knew that there were 165 sequences in the database which should have returned a hit with our sequence. How many false negatives were there, and what is the sensitivity and selectivity of Blast in this instance?
