Interested to Buy Any Domain ? << Click Here >> for more details...
Answer Posted / jyotirindra majumdar
FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.
An example sequence in FASTA format is:
>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK
| Is This Answer Correct ? | 0 Yes | 0 No |
Post New Answer View All Answers
Did shuffling of protein constituents occur between systems for multicomponent transport systems such as the atp-binding-cassette or complex protein secretion systems?
How to Count number of nucleotide substitutions ?
Is there is best online Training for Bioinformatics
Explain about the mass number of nuclear?
What is protein sequencing?
How do you customize database for blast?
Will the plant able to produce electricity when the soil is dried up
What is computational biology?
can u give me an example of a project you were involved with that illustrates your interest and skills in bringing people together?
How a cluster algorithm works?
How to identify common acc.numbers from among a set of files ?
How will you value a biotech company as opposed to a consumer products company?
What is the difference in terms of connectivity between a scale free network and random network?
Did bacteria, archaea, and eukaryotes exchange transporter genes appreciably during the past two billion years?
What is the secondary structure of intron ?
