Answer Posted / jyotirindra majumdar
FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.
An example sequence in FASTA format is:
>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK
| Is This Answer Correct ? | 0 Yes | 0 No |
Post New Answer View All Answers
How to Count number of nucleotide substitutions ?
How to caculate coordinates of each atoms on 3 D HP model?
What does the ultrametric property of a tree tell us about the evolutionary process?
How a cluster algorithm works?
Can independent origins be established for two families of transport systems having no sequence or motif similarities without three-dimensional structural data?
Did integral membrane transport proteins arise as an independent protein class or from other types of proteins?
How to find a sequence of dna molecule?
How do you customize database for blast?
Bootstrap analysis evaluates evolutionary trees by sampling columns from the original alignment with replacement (multiplying or removing some of them) and computing a proportion of times that a particular branch appears in the resulting trees. What is the main idea behind this approach?
Is there is best online Training for Bioinformatics
What is the secondary structure of intron ?
What is C-compliator?
Suppose you used the NCBI Blast server to look for a match to a fruit-fly gene. Suppose further that the best alignment contained this section of an alignment: Hit from database: XXXXXXXXXXXXXXNFSTSQ User sequence: SLEAEAAPASISPSNFSSSQ What do the Xs signify?
Explain about the mass number of nuclear?
What is the difference in terms of connectivity between a scale free network and random network?
