Interested to Buy Any Domain ? << Click Here >> for more details...
what is FASTA format?
- 4 Answers
- 10142 Views
- I also Faced
- E-Mail Answers
Answers were Sorted based on User's Feedback
Answer / devanshi
FASTA format is a text-based format for representing either
nucleic acid sequences or protein sequences, in which base
pairs or protein residues are represented using single-
letter codes. The format also allows for sequence names and
comments before the sequences.
The simplicity of FASTA format makes it easy to manipulate
and parse sequences using text-processing tools and
scripting languages like Perl.
| Is This Answer Correct ? | 7 Yes | 0 No |
Answer / bikash ranjan sahoo
It is the representation of nucleic acid or protein
sequences in terms of number of text present in different
number of codes for easy modification,retrieval and
storage.
| Is This Answer Correct ? | 5 Yes | 0 No |
Answer / neeraj verma
FASTA is a DNA and protein sequence alignment software
package first described (as FASTP)
The FASTA file format used as input for this software is now
largely used by other sequence database search tools (such
as BLAST) and sequence alignment programs (Clustal,
T-Coffee, ...)
| Is This Answer Correct ? | 2 Yes | 0 No |
Answer / jyotirindra majumdar
FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.
An example sequence in FASTA format is:
>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK
| Is This Answer Correct ? | 0 Yes | 0 No |
The rate of the first order reaction depends on the (a) Concentration of the reactant (b) Concentration of the product (c) Time (d) Temperature.
How can you have an accession number?
Suppose you used the NCBI Blast server to look for a match to a fruit-fly gene. Suppose further that the best alignment contained this section of an alignment: Hit from database: XXXXXXXXXXXXXXNFSTSQ User sequence: SLEAEAAPASISPSNFSSSQ What do the Xs signify?
How long will a train 100m long traveling at 72kmph take to overtake another train 200m long traveling at 54kmph?
How can i do the Homology Modeling of GPCR receptor successfully? My target identity with template is only 27%
How many bonds are present in CO2 molecule?
it is a common experience that if we go on burping simultaneously and consciously(i.e.purposely,as in a non- natural action),our stomach starts aching.Why does this happen?
A and B can finish a piece of work in 20 days .B and C in 30 days and C and A in 40 days. In how many days will A alone finish the job?
What is the difference between SE(Standard Error) and SEM (Standard Error of Mean) ?
If a match from a sequence database search is reported to have an E-value of 0.0, should it be considered highly insignificant or highly significant?
What is Mathematical Biology?
What are the main differences between parsimony,distance and likelihood-based algorithms?
Micro Biology 
