Interested to Buy Any Domain ? << Click Here >> for more details...
what is FASTA format?
- 4 Answers
- 10199 Views
- I also Faced
- E-Mail Answers
Answers were Sorted based on User's Feedback
Answer / devanshi
FASTA format is a text-based format for representing either
nucleic acid sequences or protein sequences, in which base
pairs or protein residues are represented using single-
letter codes. The format also allows for sequence names and
comments before the sequences.
The simplicity of FASTA format makes it easy to manipulate
and parse sequences using text-processing tools and
scripting languages like Perl.
| Is This Answer Correct ? | 7 Yes | 0 No |
Answer / bikash ranjan sahoo
It is the representation of nucleic acid or protein
sequences in terms of number of text present in different
number of codes for easy modification,retrieval and
storage.
| Is This Answer Correct ? | 5 Yes | 0 No |
Answer / neeraj verma
FASTA is a DNA and protein sequence alignment software
package first described (as FASTP)
The FASTA file format used as input for this software is now
largely used by other sequence database search tools (such
as BLAST) and sequence alignment programs (Clustal,
T-Coffee, ...)
| Is This Answer Correct ? | 2 Yes | 0 No |
Answer / jyotirindra majumdar
FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.
An example sequence in FASTA format is:
>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK
| Is This Answer Correct ? | 0 Yes | 0 No |
what is QSAR (quantitative structure-activity relationship?
If the sum of n terms of two series of A.P are in the ratio 5n+4:9n+6 .find the ratio of their 13th terms
3 Answers Deloitte, IIT, Wipro,
A man speaks the truth 3 out of 4 times. He throws a die and reports it to be a 6. What is the probability of it being a 6?
What two possibilities are there to describe how gene fragments may have evolved?
what is the use of Morphometrics?
How to assign alpha helix & beta sheets?
Can isolation of DNA done with perfection?how?
A and B can finish a piece of work in 20 days .B and C in 30 days and C and A in 40 days. In how many days will A alone finish the job?
What is the product of the irrational roots of the equation (2x-1)(2x-3)(2x-5)(2x-7)=9?
If y=cos-1(cosx + 4sinx)/(17)1/2, then dy/dx is ?
How to Count number of nucleotide substitutions ?
Did shuffling of protein constituents occur between systems for multicomponent transport systems such as the atp-binding-cassette or complex protein secretion systems?
Micro Biology 
