what is FASTA format?
- 4 Answers
- 8294 Views
- I also Faced
- E-Mail Answers
Answers were Sorted based on User's Feedback
Answer / devanshi
FASTA format is a text-based format for representing either
nucleic acid sequences or protein sequences, in which base
pairs or protein residues are represented using single-
letter codes. The format also allows for sequence names and
comments before the sequences.
The simplicity of FASTA format makes it easy to manipulate
and parse sequences using text-processing tools and
scripting languages like Perl.
| Is This Answer Correct ? | 7 Yes | 0 No |
Answer / bikash ranjan sahoo
It is the representation of nucleic acid or protein
sequences in terms of number of text present in different
number of codes for easy modification,retrieval and
storage.
| Is This Answer Correct ? | 5 Yes | 0 No |
Answer / neeraj verma
FASTA is a DNA and protein sequence alignment software
package first described (as FASTP)
The FASTA file format used as input for this software is now
largely used by other sequence database search tools (such
as BLAST) and sequence alignment programs (Clustal,
T-Coffee, ...)
| Is This Answer Correct ? | 2 Yes | 0 No |
Answer / jyotirindra majumdar
FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.
An example sequence in FASTA format is:
>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK
| Is This Answer Correct ? | 0 Yes | 0 No |
Can isolation of DNA done with perfection?how?
WHY YOU SELECT BIOINFORMATICS AS YOUR MAJOR FIELD??
Integrate 3x + 5 / (x3-x2-x+1)?
What is the science of bioinformatics?
What is the aim of Blast software?
Define perl and clustalW problem?
Suppose the Blast search returned 100 hits. Of these, 17 were false positives and we knew that there were 165 sequences in the database which should have returned a hit with our sequence. How many false negatives were there, and what is the sensitivity and selectivity of Blast in this instance?
What is the product of the irrational roots of the equation (2x-1)(2x-3)(2x-5)(2x-7)=9?
What is the largest DNA sequence comparison achieved on PatternHunter?
A catalyst (a)always slows down the reaction (b)always starts a rection that would not have ocurred at all otherwise (c)causes changes in the rate of the reaction (d)changes the quantities of the products formed.
What is the secondary structure of intron ?
How can you have an accession number?
Micro Biology 
